TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P76278|YEBZ_ECOLI Inner membrane protein YebZ OS=Escherichia coli (strain K12) GN=yebZ PE=1 SV=1
MLAFTWIALRFIHFTSLMLVFGFAMYGAWLAPLTIRRLLAKRFLRLQQHAAVWSLISATAMLAVQGGLMGTGWTDVFSPN
IWQAVLQTQFGGIWLWQIVLALVTLIVALMQPRNMPRLLFMLTTAQFILLAGVGHATLNEGVTAKIHQTNHAIHLICAAA
WFGGLLPVLWCMQLIKGRWRHQAIQALMRFSWCGHFAVIGVLASGVLNALLITGFPPTLTTYWGQLLLLKAILVMIMVVI
ALANRYVLVPRMRQDEDRAAPWFVWMTKLEWAIGAVVLVIISLLATLEPF