TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P76347|YEEJ_ECOLI Uncharacterized protein YeeJ OS=Escherichia coli (strain K12) GN=yeeJ PE=3 SV=3
MATKKRSGEEINDRQILCGMGIKLRRLTAGICLITQLAFPMAAAAQGVVNAATQQPVPAQIAIANANTVPYTLGALESAQ
SVAERFGISVAELRKLNQFRTFARGFDNVRQGDELDVPAQVSEKKLTPPPGNSSDNLEQQIASTSQQIGSLLAEDMNSEQ
AANMARGWASSQASGAMTDWLSRFGTARITLGVDEDFSLKNSQFDFLHPWYETPDNLFFSQHTLHRTDERTQINNGLGWR
HFTPTWMSGINFFFDHDLSRYHSRAGIGAEYWRDYLKLSSNGYLRLTNWRSAPELDNDYEARPANGWDVRAESWLPAWPH
LGGKLVYEQYYGDEVALFDKDDRQSNPHAITAGLNYTPFPLMTFSAEQRQGKQGENDTRFAVDFTWQPGSAMQKQLDPNE
VAARRSLAGSRYDLVDRNNNIVLEYRKKELVRLTLTDPVTGKSGEVKSLVSSLQTKYALKGYNVEATALEAAGGKVVTTG
KDILVTLPAYRFTSTPETDNTWPIEVTAEDVKGNLSNREQSMVVVQAPTLSQKDSSVSLSTQTLNADSHSTATLTFIAHD
AAGNPVVGLVLSTRHEGVQDITLSDWKDNGDGSYTQILTTGAMSGTLTLMPQLNGVDAAKAPAVVNIISVSSSRTHSSIK
IDKDRYLSGNPIEVTVELRDENDKPVKEQKQQLNNAVSIDNVKPGVTTDWKETADGVYKATYTAYTKGSGLTAKLLMQNW
NEDLHTAGFIIDANPQSAKIATLSASNNGVLANENAANTVSVNVADEGSNPINDHTVTFAVLSGSATSFNNQNTAKTDVN
GLATFDLKSSKQEDNTVEVTLENGVKQTLIVSFVGDSSTAQVDLQKSKNEVVADGNDSVTMTATVRDAKGNLLNDVMVTF
NVNSAEAKLSQTEVNSHDGIATATLTSLKNGDYRVTASVSSGSQANQQVNFIGDQSTAALTLSVPSGDITVTNTAPQYMT
ATLQDKNGNPLKDKEITFSVPNDVASKFSISNGGKGMTDSNGVAIASLTGTLAGTHMIMARLANSNVSDAQPMTFVADKD
RAVVVLQTSKAEIIGNGVDETTLTATVKDPSNHPVAGITVNFTMPQDVAANFTLENNGIAITQANGEAHVTLKGKKAGTH
TVTATLGNNNTSDSQPVTFVADKASAQVVLQISKDEITGNGVDSATLTATVKDQFDNEVNNLPVTFSSASSGLTLTPGVS
NTNESGIAQATLAGVAFGEKTVTASLANNGASDNKTVHFIGDTAAAKIIELAPVPDSIIAGTPQNSSGSVITATVVDNNG
FPVKGVTVNFTSNAATAEMTNGGQAVTNEQGKATVTYTNTRSSIESGARPDTVEASLENGSSTLSTSINVNADASTAHLT
LLQALFDTVSAGETTSLYIEVKDNYGNGVPQQEVTLSVSPSEGVTPSNNAIYTTNHDGNFYASFTATKAGVYQLTATLEN
GDSMQQTVTYVPNVANAEITLAASKDPVIADNNDLTTLTATVADTEGNAIANTEVTFTLPEDVKANFTLSDGGKVITDAE
GKAKVTLKGTKAGAHTVTASMTGGKSEQLVVNFIADTLTAQVNLNVTEDNFIANNVGMTRLQATVTDGNGNPLANEAVTF
TLPADVSASFTLGQGGSAITDINGKAEVTLSGTKSGTYPVTVSVNNYGVSDTKQVTLIADAGTAKLASLTSVYSFVVSTT
EGATMTASVTDANGNPVEGIKVNFRGTSVTLSSTSVETDDRGFAEILVTSTEVGLKTVSASLADKPTEVISRLLNASADV
NSATITSLEIPEGQVMVAQDVAVKAHVNDQFGNPVAHQPVTFSAEPSSQMIISQNTVSTNTQGVAEVTMTPERNGSYMVK
ASLPNGASLEKQLEAIDEKLTLTASSPLIGVYAPTGATLTATLTSANGTPVEGQVINFSVTPEGATLSGGKVRTNSSGQA
PVVLTSNKVGTYTVTASFHNGVTIQTQTTVKVTGNSSTAHVASFIADPSTIAATNTDLSTLKATVEDGSGNLIEGLTVYF
ALKSGSATLTSLTAVTDQNGIATTSVKGAMTGSVTVSAVTTAGGMQTVDITLVAGPADTSQSVLKSNRSSLKGDYTDSAE
LRLVLHDISGNPIKVSEGMEFVQSGTNVPYIKISAIDYSLNINGDYKATVTGGGEGIATLIPVLNGVHQAGLSTTIQFTR
AEDKIMSGTVSVNGTDLPTTTFPSQGFTGAYYQLNNDNFAPGKTAADYEFSSSASWVDVDATGKVTFKNVGSNSERITAT
PKSGGPSYVYEIRVKSWWVNAGEAFMIYSLAENFCSSNGYTLPRANYLNHCSSRGIGSLYSEWGDMGHYTTDAGFQSNMY
WSSSPANSSEQYVVSLATGDQSVFEKLGFAYATCYKNL