TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1
MHIHSDLSLPQFEHASIDPPSYSPQKSSFEEKKHNFSITNKSLETLRSQESPCSTTFPVSDRKDALLNIPTVVDDEFQHT
EELAGVSSWSDFFYLFHFSDIPLIFGTLIFTCLSAALEPLMTWTTGKVFDALSQYATSQITLGKMISLINFNSLLITIFG
LASCVFSFGVRFLWQYLSAIAGKRARSLCFHVLSSKSSTFYSLTESKSGLVNSVDRCIQFYEKSISLPMFHIAENLAISL
SCLIISFRYSWSLTLVVLASYPIIILVVGFINSFLSSAYEKDRKSSEKAASILEKSISAIQTVIFHSMQDTEYRYFADAC
STSSKSFLRFSFLDAFQGGVSQFFLYSVFFQGLWFGNHLATTKRVNVGQVVTVFGSCLSVASSLQQILPAIPDLIKGKFS
SHFIKTLCESHDPIEAAKRSAAKIKSISFERGFRFDNVSFAYPSRDENLFSLINVSVFIPFGELVHIIGPSGSGKSTFIS
LLLRYFSPTYGNIYLDDFPLEEIDEHVLGSTITLVCQQPVIFDMTIRENIIMRNENASESDFEEVCRLALVDEFALTFDQ
SYDTPCKEASLSGGQQQRIALARALLRDTEILILDEPTSALDPITKNLVMDAIRAHRKGKTTLVITHDMSQINNDELVLV
IDKGHLIQRCARKELVLFEDFENNVSIDEKVLKEEADNPFILPNEESLLEKYWINYNESFSQLSRESLFTSLESPFTDIE
SPTIVSRRKIVEQRKLRMEKESFQETNVDQTFHLFDDKEHACSLTLIFKSIWKVKKLRWFFLLGLLTSLIQGASVPIFAY
VISKCLNLFMQIDPSIGVAFWSSMVLVVAAGSGASYFFSHYIFSISAKIWCDHYRLLAVKVLFTQDQAWFDQIENYPLVL
SKILVNNISDMRNMISSLIEEVFIAFTMAIIGIAWSFATGWRLAAVLVAVSPILCLTSRMFSYIYVSTERMCQDVVISTT
SILHKTIVNLDTIKGYSVLSFFRENHKNSLRKSWEAFKRRAFWTSLGFAINNSLLYFVRALLFYCSSIFISKEFYTVEQM
VQVLSLATFTLLMASTCIMSLPNVSASRIATSRVLKLSSLKPGNLHKSGYLKFPLVGKIEFDGVSFAYPDSERNHLALNN
VSLSIEAREKVAIVGISGSGKSTLVELLRKTYPSEDIYIDGYPLTNIDTNWLLKKVAIVDQKPHLLGSTILESLLYGVDR
DINSVMDALDKTYMTEVIQNLPNGLDTPLLEFSKNFSGGQIQRLAFARALLRNPRLLILDECTSALDSKSSLLLEKTIQN
LSCTVLIITHQPSLMKLADRIIVMDSGIVKESGSFDELMNRHTHFWKLIHRGEWIE