TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P79241|FPR1_PANTR fMet-Leu-Phe receptor (Fragment) OS=Pan troglodytes OX=9598 GN=FPR1 PE=3 SV=1
NSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMV
RKAMGGHWPFGWFLCKFIFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIR
VTTVPGKTGTVACTFNFSPWTNDPKERINVAIAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKFSRPLRVL
SFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERA
LTEDSTQTSDTATNSTLPSAEVALQA