TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P91927|A60DA_DROME LETM1 and EF-hand domain-containing protein anon-60Da, mitochondrial OS=Drosophila melanogaster GN=anon-60Da PE=2 SV=2
MNALLRHKGRNLRTSHLAQNVYKRFLKSNCCACSSVNVTDEPAKEDELPRRSASTSVLELSRSLGTYRRFQPHANYGYDY
SGYGFRHLHTSRTLLETSSSKIDATVKKLKNQQKEKVEEIMKEVANGQAAAVRASSAATATASSEKGQNASATAGSTSAT
ASTTSLAKTADKSVAKPKKPLRTRIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRRENKQLQRTTSDLFRLIPF
SVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSVRLEVAKFLQQTLDQMPVQHKEHSSEEAKQFEAFFTK
IRNPTEPVSNDEIIKFAKRFDDEITLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDL
LELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKETIRVLPDAVGAHTRHAI
GESEGKVDNKTKIEIIKEEERKIREEREEEREETIAKRSAIKEEIPAPYVFAEKLSGSQDLLDHKEQSSVSETDKGISST
DVQLLSEALKTLSSDKQLVVEKETIKELKEELADYKEDVEELREVRQVVKEPVRESRAAKLLYNRVNKMISQLDNVLNDL
EARQHQIKQAESSDYAASSPTVEPQQMVHIDELVATIRRMKEASDEERFKVVGDLLVKLDADKDGVISVNEITKAVQSID
REATNIDKKQLEEFTELLSKLASRRRHEEIVHIDDLMNNIKVLKETSDEARLKHIEAVLEKFDADKDGVVTVNDIRKVLE
SIGRDNIKLSDKAIEELISLLDKEQVLQAEQKIEKAIAKSMKEAEKLKSEVDKADKDLSKLVNDIHDSAKEIQDIANEMR
DKEETVPDKAKELKAEPAFKDTAKTLKDNAKDLDDLAKDPKSDPKSPTKASTGSGPAGLSGGGPSSGSSGIATGSTTESA
LREAAERQMEKILPSTDIGLPPTIQTPSQPPTSKKATATASTLSTTITAKKLL