TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P94528|ARAN_BACSU Probable arabinose-binding protein OS=Bacillus subtilis GN=araN PE=2 SV=2
MKKMTVCFLVLMMLLTLVIAGCSAEKSSGKSGETELTFWTFNGLHEQFYVEMVKEWNKKYPDRKIKLNTVVYPYGQMHDN
LSISLIAGEGVPDIADVELARFSNFLKGSDIPLADLTPLIEKDRDKFVEARLTLYSKNGKLYGLDTHVGTTVMFYNMDVM
KKAGVNPDDIKTWDDYHKAGQKVRKVTGKPMGTVETNDSATFLSMISQQNSGYFDKNGKLILNNDTNVKTLQYLKDMIND
KTMIPAPGGGHHSEEYYGFMNQGGAASVLMPIWYMGRFIDYMPDLKGKIAIRPLPAWKEGGDRSAGLGGTATVVPKQSKH
VELAKEFLAFAKGSEEGNKKLWSVLGFDPLRWDVWSSKELKEKNKYTDYFQNGTGIFSVLLDIKDEINPIYLHEDFAKAS
DLVNRSVLFDALKSQQKTPKQALDRAAGELKQK