TCDB is operated by the Saier Lab Bioinformatics Group
>P98008|NORB_PSEST Nitric oxide reductase subunit B - Pseudomonas stutzeri (Pseudomonas perfectomarina).
MSSFNPHLKFQSQAVAKPYFVFALILFVGQVLFGLIMGLQYVVGDFLFPLLPFNVARMVHTNLLIVWLLFGFMGAAYYLI
PEESDCELHSPKLAIILFWVFAAAGVLTILGYLFVPYAALAEMTRNDLLPTMGREFLEQPTITKIGIVVVALGFLYNIGM
TMLKGRKTVVSTVMMTGLIGLAVFFLFAFYNPENLSRDKFYWWFVVHLWVEGVWELIMGAMLAFVLIKVTGVDREVIEKW
LYVIIAMALITGIIGTGHHFFWIGAPTVWLWVGSIFSALEPLPFFAMVLFALNMVNRRRREHPNKAASLWAIGTTVTAFL
GAGVWGFMHTLAPVNYYTHGSQLTAAHGHLAFYGAYAMIVMTMISYAMPRLRGLGEAPDARAQRIEVWGFWLMTISMIAI
TLFLTAAGVVQIWLQRIPADGAAMSFMNTADQLAIFFWLRFIAGVFFLIGLVCYLYSFRQRGRVPVVVAAPAAA