TCDB is operated by the Saier Lab Bioinformatics Group
>POE55702.1 hypothetical protein CFP56_27738 [Quercus suber]
MSAYGVTLSLVLLCLANVVNYSEAHINGSETEMMVPMVESGRMEKMMMVMNDRRRRLGSFQICALCTCCGGAKGLCLPSP
CCYAINCNIPNRPFGFCSFTPKTCNCFGCHL