TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q00564|LCNC_LACLA Lactococcin A transport ATP-binding protein lcnC - Lactococcus lactis (subsp. lactis) (Streptococcus lactis).
MKFKKKNYTSQVDEMDCGCAALSMILKSYGTEKSLASLRLLAGTTIEGTSALGIKKAAEILEFSVQALRTDASLFEMKNA
PYPFIAHVIKDQKYPHYYVITGANKNSVFIADPDPTIKMTKLSKEAFLSEWTGISLFLSTTPSYHPTKEKASSLLSFIPI
ITRQKKVILNIVIASFIVTLINILGSYYLQSMIDSYIPNALMGTLGIISVGLLLTYIIQQVLEFAKAFLLNVLSQRLAID
VILSYIRHIFQLPMSFFSTRRTGEITSRFSDASSILDAIASTILSLFLDLTIVVMTGLILGLQNMQLFLLVLLAIPLYIV
VIIIFTPLFEKQNHEVMQTNAVLNSSIIEDINGIETIKALASEQERYQKIDYEFASYLKKAFTLQKSEAIQGLIKAIIQL
TLSVTILWFGATLVISQKITLGQLITFNALLSYFTNPITNIINLQTKLQKARVANERLNEVYLVPSEFEEKKTELSLSHF
NLNMSDISYQYGFGRKVLSEIELSIKENEKLTIVGMSGSGKSTLVKLLVNFFQPTSGTITLGGIDLQQFDKHQLRRLINY
LPQQPYIFTGSILDNLLLGANENASQEEILKAVELAEIRADIEQMQLGYQTELSSDASSLSGGQKQRIALARALLSPAKI
LILDEATSNLDMITEKKILKNLLPLDKTIIFIAHRLSVAEMSHRIIVVDQGKVIESGSHVDLLAQNGFYEQLYHN