TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q00758|SP5B_BACSU Stage V sporulation protein B OS=Bacillus subtilis GN=spoVB PE=2 SV=1
MAKQTFLKGTLILIAAGMVTRMLGFVNRVVIARFIGEEGVGLYMMAAPTFFLATTLTQFGLPVAISKLVAEASARGDHQK
TKNILVMSLTITGVLSLIFTPLFLFFAPVMAETMLTDKRTLYPLLAITPVVPIIAISSVLRGYFQGKQNMNPLAMSQVLE
QVVRISLVAVCTTIFLPYGIEYAAAGAMLSSVAGELASLLYLFVCFKYKKTIKIRKHFLQSIKNGKQTFTQLMSVSLPTT
GSRFIGNLSWFFEPIVVAQSLAIAGVATVAATKQYGELTGFAMTLLTLPSFITYSLSTALVPAISEGMEQKKLQVVEYRL
EQAMRLCLLSGGISVVILFVFADELMRVMYGSSGAAVFIKVMAPFFLLYYFQGPLQAVLQALNLAGAAMMNSLIGALVKT
GLIFVLATRPSLGIMGAALAIVTGMVLVTLLHAATVSKVLPISIKIKEYALSFAVIVICGFISSAIKQYISFGASEAVNL
AGWIAASAAIYMILLLVFRLIKKDELRRIPIIGRLIIR