TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein precursor - Schizosaccharomyces pombe (Fission yeast).
MVLRYNSPRLNILELVLLYVGFFSIGSLNLLQKRKATSDPYRRKNRFGKEPIGIISWWILGIALTYVVDISNLVIYALRV
PNWWPCKTTVVCLILFLLFWIIVLISCADSKALPKNADSILKAYRLSVLYVWAIDIVFETIFIVYSPHPNETFQGIVLAD
HVARLVLCVFATAIYLTYRRKRHTHDPLDFEERQLTEESNVNENAISQNPSTVQLGVSASTSNFGTLKSTSKKPSDKSWA
EYFRSFSTLLPYLWPTKDYRLQFQIFICIVLLFLGRAVNILAPRQLGVLTEKLTKHSEKIPWSDVILFVIYRFLQGNMGV
IGSLRSFLWVPVSQYAYRAISTKALRHVLNLSYDFHLNKRAGEVLTALTKGSSLNTFAEQVVFQIGPVLLDLGVAMVYFF
IKFDIYFTLIVLIMTLCYCYVTVKITSWRTEARRKMVNSWRESYAVQNDAIMNFETVKNFDADDFENERYGHAVDIYLKQ
ERKVLFSLNFLNIVQGGIFTFSLAIACLLSAYRVTFGFNTVGDFVILLTYMIQLQQPLNFFGTLYRSLQNSIIDTERLLE
IFEEKPTVVEKPNAPDLKVTQGKVIFSHVSFAYDPRKPVLSDINFVAQPGKVIALVGESGGGKSTIMRILLRFFDVNSGS
ITIDDQDIRNVTLSSLRSSIGVVPQDSTLFNDTILYNIKYAKPSATNEEIYAAAKAAQIHDRILQFPDGYNSRVGERGLK
LSGGEKQRVAVARAILKDPSIILLDEATSALDTNTERQIQAALNRLASGRTAIVIAHRLSTITNADLILCISNGRIVETG
THEELIKRDGGAYKKMWFQQAMGKTSAETH