TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q03203|NIST_LACLA Nisin transport ATP-binding protein NIST - Lactococcus lactis (subsp. lactis) (Streptococcus lactis).
MDEVKEFTSKQFFYTLLTLPSTLKLIFQLEKRYAIYLIVLNAITAFVPLASLFIYQDLINSVLGSGRHLINIIIIYFIVQ
VITTVLGQLESYVSGKFDMRLSYSINMRLMRTTSSLELSDYEQADMYNIIEKVTQDSTYKPFQLFNAIIVELSSFISLLS
SLFFIGTWNIGVAILLLIVPVLSLVLFLRVGQLEFLIQWQRASSERETWYIVYLLTHDFSFKEIKLNNISNYFIHKFGKL
KKGFINQDLAIARKKTYFNIFLDFILNLINILTIFAMILSVRAGKLLIGNLVSLIQAISKINTYSQTMIQNIYIIYNTSL
FMEQLFEFLKRESVVHKKIEDTEICNQHIGTVKVINLSYVYPNSNAFALKNINLSFEKGELTAIVGKNGSGKSTLVKIIS
GLYQPTMGIIQYDKMRSSLMPEEFYQKNISVLFQDFVKYELTIRENIGLSDLSSQWEDEKIIKVLDNLGLDFLKTNNQYV
LDTQLGNWFQEGHQLSGGQWQKIALARTFFKKASIYILDEPSAALDPVAEKEIFDYFVALSENNISIFISHSLNAARKAN
KIVVMKDGQVEDVGSHDVLLRRCQYYQELYYSEQYEDNDE