TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q04853|NS12_CVHOC Non-structural protein of 12.9 kDa OS=Human coronavirus OC43 GN=5a PE=3 SV=1
MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYFGVINGFTAFA
NTVEDAVNKLVFLAVDFITWRRQELNVYG