TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q06493|YLH47_YEAST LETM1 domain-containing protein YLH47, mitochondrial OS=Saccharomyces cerevisiae GN=YLH47 PE=1 SV=1
MLKYRSLPIKRAIHHPAPGITPISPRIMVSRLRVIPSFNLKFNRWNSSVPESSKKELKTTDGNQESASKVSPVKEKEKVP
FKVKMQKALRHYWDGSKLLGLEIKISSKLLMKSAAGYPLTRRENLQLKRTTQDIVRLVPFAAFLIIPFAELLLPFALKLF
PNLLPSTYESSKKRENKLENLRNTRKLMSEIIKNNKSHFKPNNISEEQKALFNRFYTHVRATGVPESRQQLIEVARLFTD
DTVLDNVTRPYLIALAKYMNLQPFGTDVMLRYRIRYKMLELKKDDLSIYYEDAEQLSLSELKTACASRGIRSVDVEPSVL
YSNLRLWLNMRLKDKIPSTLLIMATAYNYGNVQSKESLYDALCDVLIGIPDELYHEVKVNVVKEDEASAKQKLKQLREQE
EIMKEEEQQEENAIVSVKDELSLDDQDKNIDAAAPDVKPHDTKPIGEAAAIKEK