TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q06496|NPT2_RAT RENAL SODIUM-DEPENDENT PHOSPHATE TRANSPORT PROTEIN 2 (SODIUM/PHOSPHATE COTRANSPORTER 2) (NA(+)/PI COTRANSPORTER 2) (RENAL SODIUM-PHOSPHATE TRANSPORT PROTEIN 2) (RENAL NA+-DEPENDENT PHOSPHATE COTRANSPORTER 2) - Rattus norvegicus (Rat).
MMSYSERLGGPAVSPLPVRGRHMVHGAAFAYVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ
EEEQKPEPRLSQKLAQVGTKLLKVPLMLGFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLV
QSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAA
TGYLHHVTGLVVASFNIRGGRDAPDLLKVITEPFTKLIIQLDKSVITSIAVGDESLRNHSLIRIWCQPETKEASTSMSRV
EAIGSLANTTMEKCNHIFVDTGLPDLAVGLILLAGSLVVLCTCLILLVKMLNSLLKGQVANVIQKVINTDFPAPFTWVTG
YFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQIALCHFFFNI
SGILLWYPLPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVLVNVLQ
SRSPGHLPKWLQTWDFLPRWMHSLQPLDGLITRATLCYARPEPRSPQLPPRVFLEELPPATPSPRLALPAHHNATRL