TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q082R8|Q082R8_SHEFN Putative nucleoside transport protein OS=Shewanella frigidimarina (strain NCIMB 400) GN=Sfri_1901 PE=4 SV=1
MTISQHEASFKQTNEEQLPVAKNKLHGWKHFAGLYAGEHVAATEFVIGATFVALGASTIDILLGLLIGNLLAMCSWWLLT
APIAVETRLSLYNYLNKIAGDSMTKLYNWANVIIFSVISAAMITVSSTAVRFLFDIPAQLNWYPSSLWFVMIVLAVGSIV
VVVAMYGFSTVADFSKICAPWLFVIFIAGSFTLFPVLSNHVIGSTTLTGWQDFMTIGDSSIWTGLNDKGEPGIGLLEVIG
FAWAANSITHFGLIDMAIFRFAKRKSYGLISGVGMFFGHYLAWISAGIMGAGTAVLLKTTITQLDPGDVAYHALGFSGFV
IIIIAGWTTANANLYRAGLAAQSIFVNHSRERTTAIVGLVTVVIACFPFVFSQMLPLLTYAGLLVVPVGGIVFAEHVLFP
KIGLTRYWAKYQKLSKSTPAIASWALALVFGFGLNSLDIISFYYLFIPTWIFTIIIYTVLAKKYGADLDYTGAILLDEKE
QQQITEYQDEMAKDDKPHVEDGSKLTKLLNSFAVISLMVISILAAKVMFYSPTMTIYAENKSLFETVCFVCTIIYFSCSY
IALKLRDPHEFNSMLVGP