TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q08BA4|S38A9_DANRE Sodium-coupled neutral amino acid transporter 9 OS=Danio rerio OX=7955 GN=slc38a9 PE=2 SV=1
MDEDSKPLLGSVPTGDYYTDSLDPKQRRPFHVEPRNIVGEDVQERVSAEAAVLSSRVHYYSRLTGSSDRLLAPPDHVIPS
HEDIYIYSPLGTAFKVQGGDSPIKNPSIVTIFAIWNTMMGTSILSIPWGIKQAGFTLGIIIIVLMGLLTLYCCYRVLKST
KSIPYVDTSDWEFPDVCKYYFGGFGKWSSLVFSLVSLIGAMVVYWVLMSNFLFNTGKFIFNYVHNVNTSDAFGTNGTERV
ICPYPDVDPHGNSSTSLYSGSDNSTGLEFDHWWSKTNTIPFYLILLLLPLLNFRSASFFARFTFLGTISVIYLIFLVTYK
AIQLGFHLEFHWFDSSMFFVPEFRTLFPQLSGVLTLAFFIHNCIITLMKNNKHQENNVRDLSLAYLLVGLTYLYVGVLIF
AAFPSPPLSKECIEPNFLDNFPSSDILVFVARTFLLFQMTTVYPLLGYLVRVQLMGQIFGNHYPGFLHVFVLNVFVVGAG
VLMARFYPNIGSIIRYSGALCGLALVFVLPSLIHMVSLKRRGELRWTSTLFHGFLILLGVANLLGQFFM