TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0VR69|Q0VR69_ALCBS YdaH protein OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ydaH PE=4 SV=1
MTRTHGWLARLEQLGNRLPHPTLLFVWFCLLLLPLTAVLGALDVTATHPLTDETITAHSLLDADGLRYLFTTLVGNFTGF
APLGVVLVAMLGLGVAEQSGLLSVSLASLVRRSSGGALVFTVAFAGVLSSLTVDAGYVVLIPLAGLVFQLAGRPPIAGIA
TAFAAVSGGFSANLLVGPVDATLAGLSTEAAHIIDPDRTVAATGNYWFIIASTFLVTGLVTLITRTLTEPRLAHANTVAD
ASVDAPQIHSRAMKWTGLTLAILLAGLALLVLPNDAPLRHPDTGSVLGSPFIHGLVVIVALIAGICGAVYGRVSGQFRNS
GAVITAMEVTMASMAGYLVLMFFAAQFVAWFNYSQLGLLLAVKGAAWLGALTVPKVVLLLLFVVLTALINLMIGSASAKW
SILAPVFIPMLMLLGISPEASQAAYRVGDSSTNIITPLMPYFVLVLGFARRYQPETGIGTLIALMLPYSLTLLLGWSVLL
GVWIGFGWPLGP