TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0WRW8|Q0WRW8_ARATH Cytochrome b561/ferric reductase transmembrane with DOMON related domain OS=Arabidopsis thaliana GN=At3g07575 PE=2 SV=1
MKLYSVSIIIFVLIALSTIVNAQQAATDSCNSTLPLNDLTFNTSLLQCTEAWTPQNFILRYARTAENTWSFILSAPDSSA
FIGIGFSTNGQMIGSSAIVGWIPSDGGSGTVKPYLLGGKSPGEVNPDQGDLTIVNGSLKIESVSSRLYMRFQLTATLPRQ
SLLYAVGPAGFFPSSPDFRLREHRFVTTTTINYNTGSQSVVKVSPHSKLKKTHGLMNMFGWGILIIVGAIVARHMKQWDP
TWFYAHIALQTTGFLLGLTGVICGLVLENRLKANNVSKHKGLGITILVMGVLQMLALLARPDKQSKYRKYWNWYHHNIGR
LLIILAISNIFYGIHLAKAGTSWNGGYGFAVAVLALTAIGLEVRKFLKK