TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1
MSNSQSIKIKKPRSNENFASGSYSSRRSQQIHRLSHSPMAEGFHKPKLNISPSESNLPNNVAENTTDTPVNYGSIRDENH
NSRKGKDVTLNSDEAHSENVPSTSEDPDVVRRHLGGQAADDDNFSSLQLQGGDMHRQVYRWQQEVDQNKQIRRGRSRSFS
AKVSDPNLHLRSVQDMKQAGGMRRDFLRNRASSISMSSNAHGNPNFLNRNFIEFLSVYGHFAGEELSEEDEDEDTDDFAM
PRDVNPSLIHSTVPSEQEPLISRHGRYKLQTPGNASNGKAVLLLLKSFVGTGVLFLPKAFKLGGLVFSSATLLIVGVLSH
ICFLLLIQTRMKVPGSFGDIGGTLYGPHMRFAILASIVVSQIGFSSAYISFVASTLQACVKVISTTHREYHLAVFIFIQF
LVFVPLSLVRKISKLSATALIADVFILLGILYLYFWDVITLATKGIADVAMFNKTDFSLFIGVAIFTYEGICLILPIQEQ
MAKPKNLPKLLTGVMAAISLLFISIGLLSYAAFGSKVKTVVILNMPESTFTVIIQFLYAIAILLSTPLQLFPAIAIIEQG
IFTRSGKRNRKIKWRKNYLRVLIVILAILISWAGSSRLDLFVSMVGSVCCIPLIYMYPPMLHYKACANNWILRTLDIFMF
TIGAFAMAFTTYMTFF