TCDB is operated by the Saier Lab Bioinformatics Group
>Q10SY9|Q10SY9_ORYSJ Transmembrane protein, putative, expressed - Oryza sativa subsp. japonica (Rice).
MSELASAPKVALGSIAFAVFWMMAVFPSVPFLPIGRTAGSLLSAVLMVIFHVISPDDAYASIDLPILGLLFATMVVGSYL
RNAGMFKHLGRLLAWKSQGGRDLMCRVCVVTALASALFTNDTCCVVLTEFVLELAAERNLPAKPFLLALASSANIGSAAT
PIGNPQNLVIAFNSKITFPKFLMGILPAMLVGMAVNMVMLLCMYWRELGGGAELSVDGKQMEAVEEGRSPASAKSTPQLN
GNGNTMMSLEMSENITTKHPWFMQCTEARRKLFLKSFAYVVTVGMVVAYMVGLNMSWTAITTALALVVVDFRDAEPCLDT
VSYSLLVFFSGMFITVSGFNKTGLPGAIWDFMAPYSKVNSVGGISVLSVIILLLSNLASNVPTVLLMGDEVAKAAALISP
AAVTTSWLLLAWVSTVAGNLSLLGSAANLIVCEQARRAPRNAYDLTFWQHIVFGVPSTLIVTAVGIPLIGKI