TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q12XA9|Q12XA9_METBU Uncharacterized protein OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=Mbur_0977 PE=4 SV=1
MGWIDWGDWNGDWSDVPQILETRENYIGEYTEIIAALVVKVIKVTWLPFSGTWLYQCRLKSVGKVRLNSGSPPFQLGWGS
YRSFIKLEKVESGDSAFSFTYDTSVENLGGYPHSGNHANYDTVNEIIALLTTAAISQMSQYVSYGLTAAQLIGLLCGIPD
DTDNTTEYLNAEYHYSSDVPINGAWSPESSCWYSWEMRAKGNDVVRFKLNYEFNSIELMGSPWIYYVGNNSTWILVTPPP
PSQMSSAEKEAYGLIEIPVNSIEKHASEFNLSTERVREHMDFDEPLYVIAKPNVTVETSISKSGKKMLSNDVDVKK