TCDB is operated by the Saier Lab Bioinformatics Group
>Q18K19|Q18K19_HALWD Hypothetical protein - Haloquadratum walsbyi (strain DSM 16790).
MHRRVAFGIGFTAVLFFLIQLGALALVPTFYEQGYQTVEDPTNPTNSLLYIGAILVATAVMLAAFKYELQWLVKGFITLA
AGSLAWYVFSVFFSPLLAAIPAVGLAVLLIIYPEWYIIDAAGVLMGAGAAGLFGISFGLLPALVLLSILAVYDAISVYGT
EHMLDLAAGVMDLNLPVILVIPTTLSYSLREDVSPVATDDNTNVSVSDNETHTHANELAEHDAETPSSIDETSTDDSHIR
DAFFIGLGDAVMPTVLVASAAFFLPGELTPSLGIFGIPAMTLPALTAMIGTFIGLFVLMWLVVKGRAHAGLPLLNGGAIG
GYLIGALLSGVPLIRALGL