TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CXF2|Q1CXF2_MYXXD MATE efflux family protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_6804 PE=4 SV=1
MSDAASSDATPVQDAAPGSTPSALPGRASLQDAMLRGPLLKPLLQLAVPTTLVLIAQSLVGVAENWYASFLGTEALAGVS
LVFPVVMLMTMMSNGGIGSGVASAVARALGANRREDANALVWHAVVLALAIGLVFSVLAWMTGPALYTALGGRAGALDAA
LQYSNYVFAGSIPFWLVNLLAAALRGAGEVRVPALVTLVGAAVFLVVTPGVIFGFGPVPAMGLAGAGLAMTLFYVGAALW
LLRYMASGRAAVRLTKGSLEPRLLRDILRVGLLTALSSLQPNLMVMVITAAVGLFGVEALAGYGMASRLDYLIIPILFGL
GTAVLTLVGTNVGAGQHERARRIAWLGGGLGFVAAGAIGLAAALAPEVWLHAFSREPAVVAPGLDYLRIVAPFYGLLGLG
FVLAFAAQGAGHVLWPFLAGTSRLVISAGVGWFVAARLDAGLSALFAMVAAGLVAYAGVTIVAVLAGAIFRREAAPRGT