TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D3I2|Q1D3I2_MYXXD O-antigen ABC exporter, permease protein OS=Myxococcus xanthus (strain DK 1622) GN=rfbA PE=4 SV=1
MIRLVRELYQYRGLLISLVQRELKARYRGSFLGFLWTFLNPTLHMLVYVLLFTVVMRQNIPNFPFFMFVGLLPWIWFSTS
VGGGASAISDRRDLLTKVRFPAQVLPTSVVVTNLCNFVLSLPLMLVLGMAYGQWPTWHVVLFPVVVLIQLTFTLALTYIL
AAINVTFRDLQHIVSNLLTLWFFATPVLYPLSTIQDESARSLMLALNPMVSLMTSYQAIFYEHRLPDAEPLMALAAVSVV
LLWAASSIFESRREEFAESI