TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D3I3|Q1D3I3_MYXXD O-antigen ABC exporter, ATP-binding protein OS=Myxococcus xanthus (strain DK 1622) GN=rfbB PE=4 SV=1
MPESMDAIILKDVVKSFRKRTIRGEYTTFKSELLRWLRGKRQSRDASLITALRGINLTIPKGKTVGIIGRNGSGKSTLLK
LITGIYTPTSGDLQINGRISALLDLGAGFHPDFSGRENILINGIILGMTRAEVRARMDEIIAFSELGEFIDEPVRTYSSG
MYMRLAFAVATHVDPDILIIDEILAVGDEHFSKKSLAKMMDFKRQGKTIVLVTHELGTVERWCDLAAWIDGGYVRRVGKP
SEVTAEYREAISLAEAQSAAFTPPALTEGGGALPQVPSESLPAEGPVRIHRVQLLDARGESLEVLSPEEGLEVRADFSVE
GPCEDVDFHVRLQAADGRTLYETSTRSEAVVLSRMPNPGVLRFVVERLGALGGDYSLVVSARASKGESSGRCAFRVVSAT
EEEGVFRPPHRWLVEPGANSQAGVPFEPGTSPRVEVG