TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1D664|Q1D664_MYXXD Putative cation efflux system protein czcB OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_3672 PE=4 SV=1
MRASRVGPSVLAVLLALSAASCSQQASPPTAKAPSPPPVASGGTSTPSEVALCEHRVPAELCTRCNPDLIDVFKDQDDWC
GEHGVPESQCFQCNPGLTFTARDTTPKDWCKEHAVPESRCTKCNPSLVAKFIEAGDYCREHGFPESVCPYCHPELVKAAG
AQPPTFPEPGTRVRLASAETAREAGIQTRRAVKRPFARTLDVVGQLDFNQNRLAQLSARSEALITDVRVDVGDEVKAGQP
LVLVTSGAVGADQGRLSAAQTRLTVARSALEREQQLATSGIRARKHVETAQAEVAAAEAERNAARAALSAAGANGQGPQG
TYALSAPFAGTVVARDAVAGRHASAGQPLIQVADLSTMWALLEIPEADAFQVRAGQRVTLTFESMPGQTRDATLTRVSAS
VDRASRTVRARVELPNPDGALKAGLFLRARVQVAPEHEAVLVPHAAIQRAEGQTLVFVRKQPGLYEPVAVELGASTREEV
EIVKGLSAGVEVVTTGAFLLKTEILKDSIGAGCCETAGGE