TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1DBY8|Q1DBY8_MYXXD Putative membrane protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_1583 PE=4 SV=1
MAVPPELRTAVSHPPPPGPAVAFTIRLGEALHRYGTPAHRLELLMQRVSERFGLEGRFFSTPTSIFSSFGPPEALRTSLI
RVEPGDMDLERLTLLDTLADDVIHGQVPPTEGAQRVDAILAQPERFGPALQLLCWTLAGGAAGRLFGGGLKEMAVAAFSS
LLIGTLNVLTRKQPSTARVLEPVAAILSSAVAALAASLMGPLSAQVATLAGLIVLLPGLSLTVAINELATRNLISGTSRL
TAAALVFLQLGFGVALGSRLSVVLPEPPVAPLPPALPDWTQLPMLLVAIFAVCVLFRARPRDWGWIAGACTFAFAGARLG
SLLLGAQLGAFVGALLLAMGSNALARLRNKPSITTLVPGLMLLVPGSVGFRSLSSLLERDVVAGVDTAFSMLMVAVALVA
GLLSANALVPTRKVL