TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1DDT8|Q1DDT8_MYXXD Putative uncharacterized protein OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_0924 PE=4 SV=1
MGFSEGAVFMRYPSIIAALLFTATTASAQEYDEHAHDGFYLRLQVGGGYLRAKATDVSPDLVVKGGGANINAELGFALVN
NFILYAKFYGASAPNPSLQVGDLTVEGQNENLSENFGAVGLGVTYYIMPANVYLSGALTYTQLSVTDDGEKVAESDIGGG
LHLGVGKEWWVSKNWGLGIGAELALGRIRNESNSDSWNVTNVSLVFSATYN