TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1PE15|Q1PE15_ARATH Uncharacterized protein OS=Arabidopsis thaliana GN=At4g36820 PE=2 SV=1
MVMMKKLLSNRLFNMSKTASQSLMNCRTSSSSSLAMRTRVPKDIGEATIDPEPGDLTISQRFLNKFSMNGIDTTSKMSIG
ESLMEKLKEMDMNKDRIRLDGLSHPKEETLGLTVQDVKKLLRAAEIEVIKTKLMETGKIWIRYSDFLGVCSDSSLDPSQG
ALIAKMLDDSGNVIVMGNSVCLRPHQLTKSIEGLLPLSQIHNPNDPRRKELNELEAIKTVIDQKAHSLVRRELWAGLGYL
IIQTAGFMRLTFWDLTWDVMEPICFYVSSVYFMAGYTFFLKTSREPSFQGFYQSRFEAKQRKLMQSEDFDVGRYDELKKL
FNPKPSGAVPKILGSLQN