TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1QP84|Q1QP84_NITHX Uncharacterized protein OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=Nham_1116 PE=4 SV=1
MRSVKFLVAAGAASLLSSAAFAADMPIAPPPQYYAPPPVAEFGGWYLRGDIGFSNQRVKNIAMGDGRNASLTSLNQSTAF
DTAGIFGVGLGYQFNNWFRGDITGQYRGNSNFKGTDLITFPAYGLVGQGVDNYNATKSEWLVMANGYVDLGTWWCITPFI
GAGVGVARVNIANYTDNGSNNVNYSSATDSYYLGGPNPSYASAPAASKWNFAWAAHAGLAYRVNPGLTIELAYSYVNLGS
GTTGAVSTYDGFTRGVAMKFHDITSHDVKLGVRWDLNSPPVYAPPLVTKG