TCDB is operated by the Saier Lab Bioinformatics Group
>Q1WF75|Q1WF75_9DELA Tax protein (Fragment) - Human T-lymphotropic virus 1.
FGYPVYVFGDCVQGDWCPISGGLCSARLHRHALLATCPEHQITWDPIDGRVIGSALQFLIPRLPSFPTQRTSKTLKVLTP
PITHTTPNIPPSFLQAMRKYSPFRNGYMEPTLGQHLPTLSFPDPGLRPQNLYTLWGGSVVCMYLYQLSPPITWPLLPHVI
FCHPGQLGAFLTNVPYKRIEELLYKISLTTGALIILPEDCLPTTLFQPVRAPVTLTAWQNGLLPFHSTLTTPGLIWTFTD
GTPMISGPCPKDGQPSLVLQSSSFIFHKFQTKAYHPSFLLSHGLIQYSSFHNLHLLFEEYTNIPISLLFNEKEADDNDHE
PQISPGGLEPPS