TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q21228|Q21228_CAEEL Protein K04G2.9 OS=Caenorhabditis elegans GN=CELE_K04G2.9 PE=4 SV=1
MDRREVYTTQQPDGTYVTTTTREKTKYKEHSVWSCGHGPTDKNYCLGPLGLLRIAEIFLCVVIVCLITSVFGPGPFKGIL
FGQTILLTVASVAMLLTFIFLIAYFFTLHLSHLDFFCWREADLLFNVICAVLFIVLSIVEAYYSTGSWSNNCNDIGSDGI
IHNGCRIIYEWAFASFLTFILGIFYALTAFLTHKNRHSLRNISREELY