TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q21898|VATL1_CAEEL V-type proton ATPase 16 kDa proteolipid subunit 1 OS=Caenorhabditis elegans GN=vha-1 PE=2 SV=1
MSTDTKQIIADALLKNEQAMYGPFFGSLGVTSAMAFAAAGSAYGTAKAGTGIASMAVARPDLVMKAIIPVVMAGIVAIYG
LVVAVIVSGKVEPAGANYTINNAFSQFAGGLVCGLCGLGAGYAIGIAGDAGVRALSQQPRMFVGMILILIFAEVLGLYGM
IVALILGAT