TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q21AF4|Q21AF4_RHOPB BioY protein OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_1068 PE=4 SV=1
MTPQSTIALGTRDLALIGLSAGLIVALGAVPPIVVGILPVPITLQSFGVMLAGLMFGPKRGALACLTVLALVAVGLPVLS
GGRGGLAVFAGPSAGYLLAWMPAAYIIGFLATRAEALQRPLARSAAYLFVTVLGGVIVLNLGGVLWLAAVSHISVTTVIA
GSLVFMPGDLIKAVLAVLVVRRVEALLTLPRV