TCDB is operated by the Saier Lab Bioinformatics Group
>Q26C21|Q26C21_9BACT Hypothetical transmembrane protein - Flavobacteria bacterium BBFL7.
MKRLLDIEFHKFKYSKSSKILTIIYLVIVILLMFTGLIQVDINGFKGSLSDLGIFNFPYIWHLSTYMVSFLKIFIAIVIV
SLTANEYSNRTLKQNLIDGLSKKELILSKLYLAITLALLTTMIVFIASLTLGLFYSDYLEIGIVFSKMEYLPAFFISHLM
FFCFCLFAGVLVKRSAFALGLIGVWWILELVIRGLSSFIDFKYELDTWNVIQHILPLESASLLIKEPFTKISIVQGGIEQ
LTQGQYIKDYGVSLINVATSMVWSFLFIFWSYKILKSRDL