TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2BM68|Q2BM68_9GAMM ABC taurine transporter, periplasmic ligand binding protein OS=Neptuniibacter caesariensis GN=MED92_13206 PE=4 SV=1
MKSRFNKTAGAVISGLLFSATAMAETVTIGYQGMMNPWKHVIAEKQLEAATGIDIEWRRFDSGAKVITAMASGDVDIATA
GSSPIAAAISRGVDIELVWILENINEAEALVVKGSSNIKSPQDLKGKTLGVPFVSTTHFHTLFALEQFGLSEKDVKVLNM
QPNAISAAWSRGDIDAAFIWDPVLGKIKEDGKVLISSGELSRWGKATFDGMVVSKEYGAKNPEFVSKLIKLMATADGEYL
SQKADFNADSPMAKSIAKMTGGDVNTVPGVLALYEFPTLDQQLSCSWLGCGKDGGAAKALAFTSEFLKEQGKIPKLQADY
GLFVNPSFATAAAKL