TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2BM69|Q2BM69_9GAMM Putative taurin uptake ABC transporter ATP-binding protein OS=Neptuniibacter caesariensis GN=MED92_13201 PE=3 SV=1
MNRLQINDVSVIYPGMNGGEPVRALSDINFTIEPGEFVVALGASGCGKTTLLSLMAGFIQPSAGYLTLGEHDNVEGLPRV
ACGMDLNDQITGPGQDRGVVFQKHALLPWLNVVENTEFGLKLQGVSKAERHERAAHFLKLVGLEDFHQHPVYQLSGGMQQ
RVGIARALTNDPKMLLLDEPLGALDALTREVLQELLLDVWKETQKMMFFITHSVEEALFMASRLIIMSPRPGRITHEFKL
DFNEKFLECRDARKVKSLPEFIEMREKVLAIIHGDEQEGGMH