TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2BM70|Q2BM70_9GAMM Putative taurine uptake ABC transporter permease protein OS=Neptuniibacter caesariensis GN=MED92_13196 PE=3 SV=1
MNVINQDAAIVASESVESAVEQAKPVMKPLKPLQRFKALFAAGPVKPGDAFGAPGQGKSTMISVVTSISLLLLWAVSTEL
GWIKPLFLPSPFDVVARFWEVATEGFANATLLEHTGWSMFRVFSAFALAMLTAIPIGIFMGVNRIARGLFDPIIEFYRPL
PPLAYLPLVIIWLGIGEVSKVVLIYLAIFAPMALSARAGVKSVAIEQIHAAYSMGASRWQVTRHIIMKSALPEILTGMRI
GIGFGWTTLVAAEMVAAQAGLGFMVLNAAEFLVTDVVIMGIVVIGIIAYLFDLLMRWLERKLVPWKGK