TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2F977|Q2F977_ORYSI Putative uncharacterized protein orf187 OS=Oryza sativa subsp. indica GN=orf187 PE=4 SV=1
MTRILQLQRSICITPEQWTGEGVSFIYGVWKRGRSRIDCYLKKWNGSDYPLASALTLLTTPTLCLLRFLIHVLMSISICM
ILILQSIYPLVLPIELLSMFFPFREMVAVPNAELAAVPNDQCLWGFPSLQLSPVSPMCWALNTFQDPVLVGRRFFTFVKV
VLRWNRTTLLGFRVQRAKLKRISSPLL