TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2FD71|Q2FD71_ACIBA AdeA membrane fusion protein OS=Acinetobacter baumannii GN=adeA PE=4 SV=1
MDSMQKHLLLPLFLSIGLILQGCDSKEVAQAEPPPAKVSVLSIQPQSVNFSENLPARVHAFRTAEIRPQVGGIIEKVLFK
QGSEVRAGQALYKINSETFEADVNSNRASLNKAEAEVARLKVQLERYEQLLPSNAVSKQEVSNAQAQYRQALADVAQMKA
LLARQNLNLQYATVRAPISGRIGQSFVTEGALVGQGDTNTMATIQQIDKVYVDVKQSVSEYERLQAALQSGELSANSDKT
VRITNSHGQPYNVTAKMLFEDINVDPETGDVTFRIEVNNTERKLLPGMYVRVNIDRASIPQALLVPAQAIQRNISGEPQV
YVINAQGTAEIRPIEIGHQYEQFYIANKGLKVGDKVVVEGIERIKPNQKLALAVWKAPAVANHASSVETKTSIAEGAQP