TCDB is operated by the Saier Lab Bioinformatics Group
>Q2FZR6|Q2FZR6_STAA8 Putative uncharacterized protein - Staphylococcus aureus (strain NCTC 8325).
MAENKNNLSINDDHSNAAMTHTSDAIASSDFIIRELDLNQEPEMQRESKNFWQDAWAQLKRNKLAVVGMIGLIIIVIFAF
IGPVINKHDYAEQNVEHRNLPAKIPVLDKVPFLPFDGKDADGKDAYKAANAKENYWFGTDQLGRDLWTRTWKGAQISLFI
GVVAAMLDIFIGVVYGAISGFFGGRVDTIMQRILEVIASIPNLIVVILFVLIFEPSIWTIILAMSITGWLGMSRVVRGEF
LKLKNQEFVMASKTLGASKFKLIFKHILPNTLGAIVVTSMFTVPSAIFFEAFLSFIGIGVPAPQTSLGSLVNDGRAMLLI
YPHELFIPAMILSLLILFFYLFSDGLRDAFDPKMRK