TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2NFA9|Q2NFA9_METST Conserved hypothetical membrane-spanning protein OS=Methanosphaera stadtmanae (strain DSM 3091) GN=Msp_1111 PE=4 SV=1
MELMNILTLIISLLVAVGFIGVIFRMFEKSKPSVEYIVMLAILIAIAVVANFIGSILHIDLVFFIVIMAGVVFGKESGFL
VGALSIIVFGLISGAGIGTWTPYQMIGFGLLGYTSGLFANKMESLPFRAVFGLLWGFIYGWITNISWFYFVPISVPSIIS
TYTASIFYDASRGICTLILLVIAYTWFKEIFQRNKEKYQLE