TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q31A57|Q31A57_PROM9 Adhesin-like protein OS=Prochlorococcus marinus (strain MIT 9312) GN=PMT9312_1179 PE=3 SV=1
MKISQALTSITLVFGSILSVSANEYKFEEIKFNQIPNEQNNYEPKDKLDEYIIKGANYSTKFVPLMNNGAKGDEYTGIMA
DDLNRLLVDAGFDFANAKANGEIQKIPFFAQTSVNISGGTESDTSFSINSLMKLGELAKDDQGDLKTLAFSQARFATATN
AEGSTINIGLGIRNRPDDISMVGANAFWDYRMTDYSDAHSRLGLGGEYFWKDFEFRNNWYMAITNEKDVIIKGVDYQERV
VPGWDLEVGYRLPNNPELAFYIRGFNWDYKYTQDNSGLEGAVSWQATPHVGLEAYVSNEISAASTTANTDLPGTDENFFG
LRMNITGNPVKFEKSNYKKNMVTQMTQPVKRKYDVLLERSAGGVFQNRAKGV