TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q39QA5|Q39QA5_GEOMG ATP synthase-associated magnesium import membrane protein AtpZ OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=atpZ PE=4 SV=2
MDEEKRNLIKTVGLVSSMGISMALAIIIGVVIGRQLDKWFGTHPWFFFIFLFFGIAAGFRNIYIIAGREIRKDGEDNKRG