TCDB is operated by the Saier Lab Bioinformatics Group
>Q3A7I4|Q3A7I4_PELCD Putative uncharacterized protein - Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1).
MTETAPLSLRQISRFFFPLMLNVQLMSFSHNIINMALARQNDAVTNLAAFAVALALHLFLASPGYQNHTIALALIRGKRS
LRSVSVFVIAASSAISVMLSLIAWTSLGQIVFVQLIGVSPQLATQARSVIAILAFLPFFTGLRGLCQGIVIRARHTELVS
LATLVRLFTLVIILLLAARHIPGPQLGALGLVGCIAVESLFMLWFACACGLGPAGPAKEEFGVRDTFRYSLPLAFSSAMQ
QVVPLLISAIISRLPDATLALAALGVIRGFIFLLAGPMRNLQQAYLALVHTRHDYRMLMRFFRLVAAGMAVIMLAVAYPL
NLPVLGWGMGLETELRNYIALPLASCALFPVLYGAVNLWRGLFAQCHSTGVLGWATVAKVGYLALVWPLATLSPIPISGI
ALAVFLLLSCEYCEAWYLNRRRRQLNT