TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3B5D9|Q3B5D9_PELLD Putative uncharacterized protein OS=Pelodictyon luteolum (strain DSM 273) GN=Plut_0559 PE=3 SV=1
MGSRFIFQVSISRNTLNPTLMKKFIPLSILLATLGATNAQADGQDTPPQATTNAPSWVTSWDVTVPCPVYVSENQADNIF
FEGGFDYQDARKTVDGALGYRHLMSDNKVMLGANVLYSHEFPRNHQRISYGAEIRTSVFEINSNYYHRLTDWKLTGVDNN
EEKARGGYDVELALAVPYVPSAHFRVKHFCWNGIASNDSNNPIDDLKGNTFSVSGSVYDGLSVEVGYIDYTSGNADYSKA
GGERFLKVSYNFDIFGTHVNKATKPRFSNTPYEFERMDDRRFEKIRFEQKVISAHNNEQPPA