TCDB is operated by the Saier Lab Bioinformatics Group
>Q3C2E8|Q3C2E8_9ACTO Goadsporin biosynthetic protein - Streptomyces sp. TP-A0584.
MFDTLSDRLAATFKNLRGKGRLSEADIDATAREIRIALLEADVALPVVRAFIKQVKERALGAEVSGALNPAQQVIKIVNE
ELISILGGETRRLKYAKTGPTVIMLAGLQGAGKTTLAGKLGHWLKQQKHTPLLVACDLQRPNAVNQLNVVADRAGVAFYG
PEPGNGVGDPVKVARDSIEYAKQRQYDVFIVDTAGRLGIDAEMMQQASDIRAAVQPDEVLFVVDAMVGQDAVTTAQAFLD
GVDFTGVVLSKLDGDARGGAALSVAHVTGRQIMFASNGEKVDDFDAFHPDRMASRILGMGDVLSLIEKAEQTFSQAEAEK
MAAKLQGGGKDFTLDDFLAQLEQVQKMGSISKLLGMLPGMGQIREQINNIDDRDVNRLGAIIKSMTPAERADPKIINGSR
RLRIAKGSGVQVGEVKNLVERFFDTRKMMSVMASGKGMPGIPGMGGGGKKSAKKAPAAKGRKKSGNPLKRAQEEAAAAQR
RALRAGGQQQPAPGGAFGLGAGKRPADFQLPQEFKDLL