TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q3EBY6|MCAC2_ARATH Protein MID1-COMPLEMENTING ACTIVITY 2 OS=Arabidopsis thaliana GN=MCA2 PE=2 SV=1
MANSWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNSEMNQRSEILEPLQGLDD
ALRRSYILVKSCQEKSYLYLLAMGWNIVNQFEKAQNEIDLFLKIVPLINMADNARIRERLEAIERDQREYTLDEEDRKVQ
DVILKQESTREAATSVLKKTLSRSYPNMGFCEALKTEEEKLQLELQRSRARYDADQCEVIQRLIDVTQTAATVEPNLEKV
LTKKEELTSSKKRDDLYDTDSSSIRADSRSTSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKTLFFPCGTLAKI
STVATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCALVQELREVEIHRASYGTE
KSNKEMSPPTPQFMEE