TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3J2V9|Q3J2V9_RHOS4 Putative LysE/RhtB family amino acid efflux pump OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=RHOS4_13070 PE=4 SV=1
MLFLKALLMGLAIAAPLGPIGALCIQRTLAHGFRAGMAGGLGTALADACYAAAAAAGFAAFAAALDRIQLPLGLGGGLFL
IWLGLKGLRPEPPAAAAAAAAPRGLWSTLAATFLLTLANPATILSFAAIFAGLGLAREADLASGATVVAGVFAGSMLWWI
LLAGGVALAQRHLPRAFATWVARASGALMLAFGLWALAAAFG